PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09618A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 158aa    MW: 17286.8 Da    PI: 11.9079
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09618AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.15.6e-104175136
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
                               rg W + Ed +l+++v+++G+ +W++Ia+ +  gR 
  Oropetium_20150105_09618A 41 RGHWRPAEDAKLKELVARYGPQNWNLIAENLE-GRR 75
                               899****************************9.663 PP

2Myb_DNA-binding36.89e-121041381147
                                HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +l+ a + +G + W++Iar ++ gRt++ +k++w+ +
  Oropetium_20150105_09618A 104 RLLAAYRAYGDR-WALIARLFP-GRTDNAVKDHWHVL 138
                                899*******99.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3473680IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-113774IPR009057Homeodomain-like
SMARTSM007172.5E-1040141IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-154180IPR009057Homeodomain-like
PfamPF002498.1E-94174IPR001005SANT/Myb domain
CDDcd001674.88E-84474No hitNo description
PROSITE profilePS5129412.63989143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-10103141IPR009057Homeodomain-like
PfamPF002491.3E-8104138IPR001005SANT/Myb domain
CDDcd001678.47E-8105139No hitNo description
SuperFamilySSF466894.49E-15111139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MAAGTFGRAP PAVAFPPFQE EQEQQVVVAD GGGGQGKRCG RGHWRPAEDA KLKELVARYG  60
PQNWNLIAEN LEGRRLGKSL LVAVVQPARP ARHPTRVLGG GGARLLAAYR AYGDRWALIA  120
RLFPGRTDNA VKDHWHVLMA RRQRERSGSP RRRKPAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-18411427107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140154RRQRERSGSPRRRKP
2149153PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967704.12e-53PREDICTED: myb-related protein Myb4-like
TrEMBLK3XSY42e-53K3XSY4_SETIT; Uncharacterized protein
STRINGSi005038m6e-53(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-29myb domain protein 105